Search results for "Physics::Accelerator Physics"

showing 10 items of 1235 documents

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct

Accumulation of positrons from a LINAC based source

2020

International audience; The GBAR experiment aims to measure the gravitational acceleration of antihydrogen H̅. It will use H̅+ ions formed by the interaction of antiprotons with a dense positronium cloud, which will require about 1010 positrons to produce one H̅+. We present the first results on the positron accumulation, reaching 3.8±0.4×108 e+ collected in 560 s.

010302 applied physicsPhysicsMeasure (physics)General Physics and Astronomy02 engineering and technology021001 nanoscience & nanotechnologyGravitational acceleration01 natural sciencesLinear particle acceleratorPositroniumNuclear physicsPositronPositron plasma; Positron accumulation; Antimatter; Penning-Malmberg trap; Greaves-Surko trap; GBAR[PHYS.QPHY]Physics [physics]/Quantum Physics [quant-ph]AntiprotonAntimatter0103 physical sciences[PHYS.HEXP]Physics [physics]/High Energy Physics - Experiment [hep-ex]Physics::Accelerator PhysicsPhysics::Atomic Physics0210 nano-technologyAntihydrogenComputingMilieux_MISCELLANEOUSActa Physica Polonica A
researchProduct

Hot-cavity studies for the Resonance Ionization Laser Ion Source

2016

International audience; The Resonance Ionization Laser Ion Source (RILIS) has emerged as an important technique in many Radioactive Ion Beam (RIB) facilities for its reliability, and ability to ionize target elements efficiently and element selectively. GISELE is an off-line RILIS test bench to study the implementation of an on-line laser ion source at the GANIL separator facility. The aim of this project is to determine the best technical solution which combines high selectivity and ionization efficiency with small ion beam emittance and stable long term operation. The ion source geometry was tested in several configurations in order to find a solution with optimal ionization efficiency an…

010302 applied physicsPhysicsNuclear and High Energy PhysicsIon beamTitanium sapphire laser[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]Ion gun7. Clean energy01 natural sciencesIon sourceAtmospheric-pressure laser ionizationHot cavityRadioactive Ion BeamWork function materialResonant Ionization Laser Ion SourceIon beam depositionIonization0103 physical sciencesPhysics::Accelerator PhysicsThermal emittanceAtomic physicsBeam emittance010306 general physicsInstrumentation
researchProduct

H− extraction systems for CERN’s Linac4 H− ion source

2018

Abstract Linac4 is a 160 MeV linear H −  accelerator at CERN. It is an essential part of the beam luminosity upgrade of the Large Hadron Collider (LHC) and will be the primary injector into the chain of circular accelerators. It aims at increasing the beam brightness by a factor of 2, when compared to the currently used 50 MeV linear proton accelerator, Linac2. Linac4’s ion source is a cesiated RF-plasma H −  ion source. Several beam extraction systems were designed for H −  beams of 45 keV energy, 50 mA intensity and an electron to H −  ratio smaller than 5. The goal was to extract a beam with an rms-emittance of 0 . 25 π  mm mrad. One of the main challenges in designing an H −  extraction…

010302 applied physicsPhysicsNuclear and High Energy PhysicsLarge Hadron ColliderParticle acceleratorElectron01 natural sciencesIon sourceLinear particle accelerator010305 fluids & plasmasIonlaw.inventionNuclear physicslaw0103 physical sciencesPhysics::Accelerator PhysicsThermal emittanceInstrumentationBeam (structure)Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment
researchProduct

Radiation emission at channeling of electrons in a strained layer undulator crystal

2013

Abstract Experiments have been performed at the Mainz Microtron MAMI to explore the radiation emission spectra from a crystalline undulator at electron beam energies of 270 and 855 MeV. The epitaxially grown graded composition strained layer Si 1 - x Ge x undulator had 4-period with a period length λ u = 9.9 μ m . Spectra taken at the beam energy of 270 MeV at channeling in the undulating (110) planes exhibit a broad excess yield around the theoretically expected photon energies of 0.069 MeV, as compared with a flat silicon reference crystal. Model calculations on the basis of synchrotron-like radiation emission from finite single arc elements, taking into account also coherence effects, su…

010302 applied physicsPhysicsNuclear and High Energy PhysicsPhotonSiliconchemistry.chemical_elementElectronUndulator01 natural sciencesSpectral lineCrystalchemistry0103 physical sciencesCathode rayPhysics::Accelerator PhysicsAtomic physicsNuclear Experiment010306 general physicsInstrumentationMicrotronNuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms
researchProduct

Gasdynamic ECR ion source for negative ion production

2018

H− ion sources are needed in various areas of accelerator technology, such as beam injection into cyclotrons and storage rings and as a part of neutral beam injectors for plasma heating in experimental facilities studying thermonuclear fusion. It was recently demonstrated that gasdynamic ion source based on ECR discharge in a simple mirror trap is very efficient for proton beam production [1]. Here we use the gasdynamic plasma source as the first stage driver of volumetric negative ion production through dissociative electron attachment (DEA) [2]. Experiments were performed with a pulsed 37 GHz / up to 100 kW gyrotron radiation in a dual-trap magnetic system, which consists of two identical…

010302 applied physicsThermonuclear fusionMaterials scienceCyclotronElectronPlasma01 natural sciencesIon sourcelaw.inventionIonPhysics::Plasma PhysicslawGyrotron0103 physical sciencesPhysics::Accelerator PhysicsAtomic physics010306 general physicsInstrumentationMathematical PhysicsBeam (structure)Journal of Instrumentation
researchProduct

Stealth dicing with ultrafast Bessel beams with engineered transverse profiles

2017

International audience; We investigate high-speed glass cleaving with ultrafast laser beams with engineered transverse intensity profile. We achieve accuracy of ~ 1 µm at 25 mm/s and drastically enhance cleavability compared to standard Bessel beams.

010302 applied physics[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics]Materials scienceScanning electron microscopebusiness.industryLaser cutting02 engineering and technology021001 nanoscience & nanotechnology01 natural sciences7. Clean energyIntensity (physics)symbols.namesakeTransverse planeOptics0103 physical sciencessymbolsPhysics::Accelerator PhysicsWafer dicing0210 nano-technologybusinessUltrashort pulseBessel functionLaser beams
researchProduct

Wetting Patterns Estimation Under Subsurface Drip Irrigation Systems for Different Discharge Rates and Soil Types

2018

Knowledge about the moisture distribution pattern shape and volume of soil wetted by an emitter is the basic need for better subsurface drip irrigation system. The dimensions of the pattern are imperative in selecting the right spacing between emitters and the suitable distance between laterals.

0106 biological sciencesSoil classificationSoil scienceDrip irrigation010501 environmental sciences01 natural sciencesPhysics::GeophysicsMoisture distributionVolume (thermodynamics)Physics::Accelerator PhysicsEnvironmental scienceWettingPhysics::Atmospheric and Oceanic Physics010606 plant biology & botany0105 earth and related environmental sciencesCommon emitter
researchProduct

Laser-assisted narrow gap arc welding of an 18MND5 steel thick plate

2020

Abstract Narrow gap arc welding is a common solution for the welding of thick structures. In this study, a defocused laser beam is used to pre-melt the narrow gap walls in front of an arc-welding bath. Such a welding configuration can be referred to a hybrid welding configuration. In the present work, a particular attention is given to evaluation of the interaction between an arc plasma and a defocused laser beam. High-speed imaging of the metal transfer through arc plasma is achieved thanks to a diode laser illumination system. Electrical arc parameters are logged, synchronously, in order to perform a correlation analysis and to make a diagnosis of the interaction level between laser beam …

0209 industrial biotechnologyMaterials sciencebusiness.industryPhysics::Optics02 engineering and technologyWeldingPlasma010501 environmental sciencesLaser assisted01 natural scienceslaw.inventionArc (geometry)Electric arc[SPI]Engineering Sciences [physics]020901 industrial engineering & automationOpticslawNarrow gapPhysics::Accelerator PhysicsGeneral Earth and Planetary SciencesArc weldingbusiness0105 earth and related environmental sciencesGeneral Environmental ScienceDiodeProcedia CIRP
researchProduct

pH-sensitive vibrational probe reveals a cytoplasmic protonated cluster in bacteriorhodopsin

2017

Infrared spectroscopy has been used in the past to probe the dynamics of internal proton transfer reactions taking place during the functional mechanism of proteins but has remained mostly silent to protonation changes in the aqueous medium. Here, by selectively monitoring vibrational changes of buffer molecules with a temporal resolution of 6 µs, we have traced proton release and uptake events in the light-driven proton-pump bacteriorhodopsin and correlate these to other molecular processes within the protein. We demonstrate that two distinct chemical entities contribute to the temporal evolution and spectral shape of the continuum band, an unusually broad band extending from 2,300 to well…

0301 basic medicineModels MolecularCytoplasmNuclear TheoryMolecular ConformationInfrared spectroscopyIonic bondingProtonationBuffers010402 general chemistry53001 natural sciences03 medical and health sciencesDeprotonationSpectroscopy Fourier Transform InfraredMoleculeNuclear ExperimentMultidisciplinarybiologyChemistryWaterBacteriorhodopsinHydrogen-Ion Concentration0104 chemical sciencesKinetics030104 developmental biologyPNAS PlusChemical physicsCytoplasmTemporal resolutionBacteriorhodopsinsbiology.proteinPhysics::Accelerator PhysicsProtonsMetabolic Networks and PathwaysProtein Binding
researchProduct